PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta001821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 388aa    MW: 43815.4 Da    PI: 4.3995
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-56782550PU_refplantGDBView CDS
gnl|UG|Pta#S25635725PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.3e-19144197356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t++q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pta001821 144 KKRRLTADQVQFLERSFEIENKLEPERKIQLAKELGLQPRQVAVWFQNRRARWK 197
                56789************************************************9 PP

2HD-ZIP_I/II131.53.2e-42143234192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+++qv++LE+sFe e+kLeperK +la+eLglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++y++l+ + ++L ke+++Lr+e++
    Pta001821 143 EKKRRLTADQVQFLERSFEIENKLEPERKIQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYDILKSRYENLRVDYDSLLKEKDKLRAEVT 234
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.42E-20132201IPR009057Homeodomain-like
PROSITE profilePS5007117.491139199IPR001356Homeobox domain
SMARTSM003891.1E-19142203IPR001356Homeobox domain
PfamPF000465.8E-17144197IPR001356Homeobox domain
CDDcd000861.03E-19144200No hitNo description
Gene3DG3DSA:1.10.10.607.4E-21145206IPR009057Homeodomain-like
PRINTSPR000311.1E-5170179IPR000047Helix-turn-helix motif
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5179195IPR000047Helix-turn-helix motif
PfamPF021836.2E-16199240IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MGIVVPAVWY LACELSGEAA SFAIKFTYLW ETTGFANDSE VGICSAFNAT GGHRLKEFFS  60
EEMMMSGGRM YGGPNVLVMG NENISRSADA LEALLSSPVF NGSRSVANLE EVIGNVSKRS  120
FYNSFDQEET GDEDLDDCIH PPEKKRRLTA DQVQFLERSF EIENKLEPER KIQLAKELGL  180
QPRQVAVWFQ NRRARWKTKQ LERDYDILKS RYENLRVDYD SLLKEKDKLR AEVTFLTDKL  240
HDSDHEALTK DSESADKKVY PQPASHSDCV GEPERSTAAK DTPPGCKHED LLSSGTDSSG  300
VLDEDSPHHV DCGHSSLDHV NSHLFEADQS DLSHAEEEEE EEGMSEKLLP QTYAYHLLKV  360
EDGAYPDASI AYNDMFVLED QVQLPWWD
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1191199RRARWKTKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Pta.173340.0root| shoot
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ022835e-54HAT5_ARATH; Homeobox-leucine zipper protein HAT5
TrEMBLD5AB830.0D5AB83_PICSI; Putative uncharacterized protein
STRINGPOPTR_0015s07640.13e-86(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G01470.12e-55homeobox 1