PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pta001821
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Acrogymnospermae; Pinidae; Pinales; Pinaceae; Pinus; Pinus
Family HD-ZIP
Protein Properties Length: 388aa    MW: 43815.4 Da    PI: 4.3995
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Pinus_taeda-56782550PU_refplantGDBView CDS
gnl|UG|Pta#S25635725PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.41.3e-19144197356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k++++t++q++ Le+ Fe ++++  e++ +LAk+lgL+ rqV vWFqNrRa++k
  Pta001821 144 KKRRLTADQVQFLERSFEIENKLEPERKIQLAKELGLQPRQVAVWFQNRRARWK 197
                56789************************************************9 PP

2HD-ZIP_I/II131.53.2e-42143234192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  ekkrrl+++qv++LE+sFe e+kLeperK +la+eLglqprqvavWFqnrRAR+ktkqlE+dy+ Lk++y++l+ + ++L ke+++Lr+e++
    Pta001821 143 EKKRRLTADQVQFLERSFEIENKLEPERKIQLAKELGLQPRQVAVWFQNRRARWKTKQLERDYDILKSRYENLRVDYDSLLKEKDKLRAEVT 234
                  69**************************************************************************************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466893.42E-20132201IPR009057Homeodomain-like
PROSITE profilePS5007117.491139199IPR001356Homeobox domain
SMARTSM003891.1E-19142203IPR001356Homeobox domain
PfamPF000465.8E-17144197IPR001356Homeobox domain
CDDcd000861.03E-19144200No hitNo description
Gene3DG3DSA:1.10.10.607.4E-21145206IPR009057Homeodomain-like
PRINTSPR000311.1E-5170179IPR000047Helix-turn-helix motif
PROSITE patternPS000270174197IPR017970Homeobox, conserved site
PRINTSPR000311.1E-5179195IPR000047Helix-turn-helix motif
PfamPF021836.2E-16199240IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top